Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Barrow Straps

Carping Cordage QuickClip Bungee Barrow Strap. 

A 3m rugged elastic barrow strap designed to secure your tackle onto your barrow for transportation. Constructed using 5mm bungee shock cord and featuring an Easy-Loop QuickClip for securing the bungee cord ensuring your tackle stays put on the barrow. Quick to tension. Easy to release, even when wearing thick gloves.

2 product(s) found for "Barrow Straps"
Camo Green QuickClip Bungee ..
Barrow Straps
Camo Green QuickClip Bungee ..
Carping Cordage Camo QuickClip Bungee Carp Fishing Barrow Strap 5mm x 3m A 3m rugged elastic barrow strap designed to secure your tackle onto your barrow for transportation. Constructed using 5mm bungee...
£13.95
Units in Stock: 2
£13.95
Details
Add To Cart
Carping Cordage Camo QuickClip Bungee Carp Fishing Barrow Strap 5mm x 3m A 3m rugged elastic barrow strap designed to secure your tackle onto your barrow for transportation. Constructed using 5mm bungee...
Olive Green QuickClip Bungee..
Barrow Straps
Olive Green QuickClip Bungee..
Carping Cordage Camo QuickClip Bungee Carp Fishing Barrow Strap 5mm x 3m A 3m rugged elastic barrow strap designed to secure your tackle onto your barrow for transportation. Constructed using 5mm bungee...
£13.95
Units in Stock: 3
£13.95
Details
Add To Cart
Carping Cordage Camo QuickClip Bungee Carp Fishing Barrow Strap 5mm x 3m A 3m rugged elastic barrow strap designed to secure your tackle onto your barrow for transportation. Constructed using 5mm bungee...
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i